General Information

  • ID:  hor003132
  • Uniprot ID:  P48098
  • Protein name:  Peptide YY-like
  • Gene name:  pyy
  • Organism:  Lampetra fluviatilis (European river lamprey) (Petromyzon fluviatilis)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  Gut and medial reticulospinal neuron system in the brainstem.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lampetra (genus), Petromyzontidae (family), Petromyzontiformes (order), Hyperoartia (class), Cyclostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  FPPKPDNPGDNASPEQMARYKAAVRHYINLITRQRY
  • Length:  36(28-63)
  • Propeptide:  MVSPRVRLAALALSVCAILCLGMHASAFPPKPDNPGDNASPEQMARYKAAVRHYINLITRQRYGKRALTPENWIYRDPAEERVTYGLDDYAMW
  • Signal peptide:  MVSPRVRLAALALSVCAILCLGMHASA
  • Modification:  T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Gastrointestinal hormone and neuropeptide.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P48098-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003132_AF2.pdbhor003132_ESM.pdb

Physical Information

Mass: 484022 Formula: C187H289N57O53S
Absent amino acids: CW Common amino acids: P
pI: 10.17 Basic residues: 7
Polar residues: 9 Hydrophobic residues: 9
Hydrophobicity: -116.39 Boman Index: -10477
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 51.67
Instability Index: 5996.11 Extinction Coefficient cystines: 4470
Absorbance 280nm: 127.71

Literature

  • PubMed ID:  8028041
  • Title:  Neuropeptide role of both peptide YY and neuropeptide Y in vertebrates suggested by abundant expression of their mRNAs in a cyclostome brain.